PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.004G205500.1
Common NamePOPTR_0004s21550g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family Nin-like
Protein Properties Length: 926aa    MW: 102798 Da    PI: 6.7615
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.004G205500.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK90.41.4e-28594644252
              RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                         ek+isle+l+++F++++kdAAk++gvc+T+LKriCRq+GI RWP+Rkik++
  Potri.004G205500.1 594 EKTISLEVLRQHFAGSLKDAAKSIGVCPTTLKRICRQHGITRWPSRKIKKV 644
                         79***********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.041583664IPR003035RWP-RK domain
PfamPF020423.9E-25596644IPR003035RWP-RK domain
SuperFamilySSF542771.5E-21807902No hitNo description
Gene3DG3DSA:3.10.20.2409.4E-22815897No hitNo description
PROSITE profilePS5174521.608816899IPR000270PB1 domain
SMARTSM006662.5E-24816899IPR000270PB1 domain
CDDcd064071.37E-42817898No hitNo description
PfamPF005641.8E-15817898IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 926 aa     Download sequence    Send to blast
MDDGNGPNFI PDSAFENFSG SSMDLDFMDD LLYEGCWLET ADEFNFLQAG TISSSDLNDP  60
RQYFPLFEPN SSNSNVNSHQ ENYQDQSGSF PVESNELGRR LWIAPTATGP SSPVRDRLMH  120
AIGQVKECTK DRDVLIQIWV PVKKEGKNVL TTIGQPYLLD RKCQSLASYR NVSKDFQFPA  180
DEDSKELVGL PGRVFLRELP EWTPDVRFFS GVEYLRKNHA KQFNIRGSLA VPVFEQGSRT  240
CLGVIEVVTT TRDISYRPDL ENVCKALEAV DLRSPQDFCP PSLKAKVCQA AAPEISKILE  300
SVCKAHRLPL ALAWAPCFRE GKGGCRHFDE SYSYFISLVN SAYFVAERDD WGFYMACSEQ  360
YLSFGHGIVG RAFATNKQCL STDVAAFSKT DYPLSHHAKM FGLHAAIAIP LQSSYAGSAD  420
FVLELFLPKD CRNTEEQKQM WDILPITVQQ ACQSWHVIMD KELEETVNKK MVVASDERFH  480
KDESQKFASS LFKDSSKAES SWIARTVEAQ QKGKGVSVSW DHTKEEPREE FKVKSQWGRT  540
QDDTYHKQAF PAFGQFQQNS GPKSSIEAGT DSSSAGRHSL GSIKFGDKRR TKTEKTISLE  600
VLRQHFAGSL KDAAKSIGVC PTTLKRICRQ HGITRWPSRK IKKVGHSLKK LQLVIDSVQG  660
AEGAIQMGSF YATFPELTSP NLSGNGGLPS TKTDENFKQL NPQPESGIFS AAPSALKSPS  720
SSCSHSSGSS ICCSIGVKQD TTTNNGSVSG DPLMVEDHGD VLKRTHSDAE LHALNRDETK  780
LLVRSQSHKT FGDLPSPKTL PPLPKSSSRV IRDGGGFRVK ATFGADKIRF TLQPNWGFRD  840
LQQETARRFN LDDISGIDLK YLDDDLEWVL LTCDADLEEC RDVYKLSEIH TIKISLHQPA  900
QPHLGSSLES RGPHLGSSLG TGVPF*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006384842.10.0nodule inception family protein
SwissprotQ7X9B90.0NLP2_ARATH; Protein NLP2
TrEMBLU5GKC20.0U5GKC2_POPTR; Nodule inception family protein
STRINGPOPTR_0004s21550.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF12373399
Representative plantOGRP2991697
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35270.10.0Nin-like family protein